PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN42028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 700aa    MW: 76050.5 Da    PI: 7.0139
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN42028.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-094725091954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  KHN42028.1 472 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 509
                 664559******************************88 PP

2BELL120.38.4e-39331402172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ ++g g+a pYt+lA+ka+SrhFrcLk+ai+ q+
  KHN42028.1 331 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLMMGFGAAVPYTALAQKAMSRHFRCLKEAITAQL 402
                 589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-76264400IPR006563POX domain
PfamPF075261.5E-51269399IPR006563POX domain
PROSITE profilePS5007112.568450513IPR001356Homeobox domain
CDDcd000862.57E-12453514No hitNo description
SMARTSM003891.2E-9453517IPR001356Homeobox domain
SuperFamilySSF466893.34E-17454520IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-29456519IPR009057Homeodomain-like
PfamPF059203.5E-18470509IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MSQDFQQGIF SFPNGLERGR LVSPQQQIRR DKVRFEAAAP LVGIEEEEPV YETAGMLSEM  60
FNFPPATELL EQQHATATFR AARQAGEWYG NRQQQQQQIS GINADSAAAM QLFLMNPQTR  120
SPSPPQTHAT PSSTLHMLLP NPSSNSSLQG FTGSAAGGSF GQFTWVPESA HQQGGVVEGQ  180
GLSLSLSSSL EAAKAEELRM GDSGFLYYNH QQGGGGGGGS SSSSAVQFQY KNNNNNHHQA  240
LHLQGAMGHD NNHQGHVGFG SSSLGVVNVL RNSKYAKAAQ ELLEEFCSVG RGQFKKSKFN  300
RQNSNPNSNA GGGASPSSKD APPPPPLSAA DRIEHQRRKV KLLSMLDEVD RRYNHYCEQM  360
QMVVNSFDLM MGFGAAVPYT ALAQKAMSRH FRCLKEAITA QLKQSCEVLG EKDGAGNSGG  420
LTKGETPRLK MLEQSLRQQR AFHQMGMMEQ EAWRPQRGLP ERSVNILRAW LFEHFLHPYP  480
SDADKHLLAR QTGLSRNQVS NWFINARVRL WKPMVEEMYQ QELKEAESAE DRENNNSNIS  540
GNQAQTPTTP SAATTSTATA TAPPPPPSTT TGKRSDAINA PDSDPSQHVA MNNRQGFSEN  600
QAKKSTASTT ATTIASEVAP PVSQCFDDSD LPAHRLMASD DTCHLVTADF GTASASADIG  660
STLIRFGTTP GDVSLTLGLR HAGNMPSEKT PFSVREFGAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16459517563Homeobox protein Meis2
3k2a_B1e-16459517563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003538830.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_014619348.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-177BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0B2SBB10.0A0A0B2SBB1_GLYSO; BEL1-like homeodomain protein 2
STRINGGLYMA11G06640.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35243257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-137BEL1-like homeodomain 2
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]